Выкуп и доставка товаров из интернет-магазинов США и Европы Расчёт заказа
8 (925) 424-17-07 WhatsApp
+ вся Россия
Email: zakaz@maxi-sale.ru
1 USD = 111.33 ₽
1 EUR = 115.06 ₽
Вход на сайт
:
:
Забыли пароль?
Войти
Регистрация
!
Для совершения заказов необходимо зарегистрироваться

Начало Amazon (США) Инструменты и товары для ремонта Garnier SkinActive Micellar Cleansing Water, For All Skin Types, 13.5 fl. oz.

Инструменты и товары для ремонта из Amazon

Разделы магазина Amazon

Garnier SkinActive Micellar Cleansing Water, For All Skin Types, 13.5 fl. oz.

Модель: NA
Артикул: K1983901
EAN (European Article Number): 0603084454501
UPC (Universal Product Code): 603084454501
Бренд: Garnier
ParentASIN: B07BHQV5YP
Garnier SkinActive Micellar Cleansing Water, For All Skin Types, 13.5 fl. oz.
swatchvariantvariantvariantvariantprimary
variantvariantvariantvariantvariant
Укажите количество: 100% оригинал.
Доставка в Россию через 2-4 недели.
Продавец: Amazon.com
Лучшее предложение по цене: $8.99 $6.96 вы экономите $2.03!
Состояние: Новый
Наличие на складе в США: Есть в наличии. Отгрузка со склада продавца в течение 24 часов. Продавец взимает оплату за доставку товара до склада Maxi-Sale в США.
Рекомендуемая производителем цена: $8.99
Мин. цена за новые: $6.96 (18 шт.)
Посмотреть другие предложения от продавцов на Amazon.com
Габариты товара: 6.93 см × 6.93 см × 5.51 см (273 hundredths-inches × 273 hundredths-inches × 217 hundredths-inches)
Вес товара: 0.440 кг
Габариты упаковки: 17.78 см × 5.08 см × 6.86 см (700 hundredths-inches × 200 hundredths-inches × 270 hundredths-inches)
Вес упаковки: 0.431 кг, приблизительная стоимость доставки в Россию (Москва) $8.62
Тип товара: Косметика, уход за телом и лицом (BEAUTY)
Товарная группа: Косметика и парфюмерия (Beauty)
Размер/длина/объём: 1 Count
Цвет: Normal

Характеристики

Характеристики на английском языке

  • Garnier Micellar Cleansing Water is a makeup remover and facial cleanser for face, lips and eyes that soothes and refreshes skin in just one step
  • This Garnier micellar cleansing water removes dirt, excess oil and impurities and can also be used to remove face makeup and eye makeup
  • Micellar water suitable for all skin types is a paraben-free, fragrance-free, sulfate-free and silicone-free face cleanser
  • A no-rinse makeup remover and facial cleanser that refreshes, soothes and effectively cleanses skin without harsh rubbing
  • Garnier micelle cleansing molecules lift dirt and impurities like a magnet, without irritation and this face cleanser can be used for all skin types, even sensitive skin

Подробное описание

Подробное описание на английском языке

This all-in-1 micellar cleansing water is a facial cleanser and makeup remover that is surprisingly powerful, yet gentle on skin. This micellar water for all skin types effectively cleanses, removes makeup, and refreshes skin. Like a magnet, micelles capture and lift away dirt, oil and makeup without harsh rubbing. This makeup remover for normal skin cleanses to remove makeup and leaves skin with a matte and natural finish with no greasy residue. This Garnier micellar water is gentle on skin and can be used as an eye makeup remover. This gentle cleanser is oil-free, paraben-free, fragrance-free, sulfate-free and silicone-free. Suitable for all skin types, even sensitive.

This travel size Garnier Micellar Cleansing Water is a makeup remover and facial cleanser for face, lips and eyes that soothes and refreshes skin in just one step
This travel size Garnier micelllar cleansing water removes dirt, excess oil and impurities and can also be used on-the-go to remove face makeup and eye makeup
Micellar water suitable for all skin types is a paraben-free, fragrance-free, sulfate-free and silicone-free face cleanser
A no-rinse makeup remover and facial cleanser that refreshes, soothes and effectively cleanses skin without harsh rubbing
Garnier micelle cleansing molecules lift dirt and impurities like a magnet, without irritation and this face cleanser can be used for all skin types, even sensitive skin

Based on Nielsen data for dollar and unit sales in food, drug and major discount retailers during the latest 52 week period ending 8/26/17.

A different way to cleanse. Garnier Micellar Cleansing Water is the all-in-one way to cleanse, remove makeup and refresh, no matter your skin type. Now America's Number 1 Micellar Brand is available for all skin types and for on-the-go needs. This face wash and makeup remover is oil-free, silicone-free, sulfate-free, fragrance-free and paraben-free.

DIRECTIONS: Saturate a cotton pad with the Garnier Micellar Cleansing Water for oily skin. TO REMOVE EYE MAKEUP: Hold pad over closed eyes for a few seconds, then gently wipe away makeup without harsh rubbing. TO CLEANSE SKIN & REMOVE FACE MAKEUP: Gently wipe pad all over face until skin is completely clean and makeup and impurities are removed. Use daily. No need to rinse.

Avoid contact with eyes. If contact occurs, rinse thoroughly with water.

Похожие товары

Аксессуары

    Раздел в каталоге Amazon: Косметика, парфюмерияУход за кожейЛицоОчищающие средства

    Maxi-Sale.ru is a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for sites to earn advertising fees by advertising and linking to Amazon.com.

    Вы оплачивате: Наличные в терминалах Visa QIWI Wallet Visa MasterCard WebMoney Работаем с: Райффайзенбанка Альфа-Банк Юнителлер Сбербанк России
    Мы доставляем: USPS UPS Fedex EMS Автотрейдинг Экспресс-альянс